A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10001
Swiss-prot Accession number	Q95JC9 (Sequence in FASTA format)
Description	Basic proline-rich protein precursor [Contains: Proline-rich peptideSP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone(PH-Ab)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	Acinar cells and secretory granules of the parotid gland
Post translational modification	N/A
Function	The parotid hormone stimulates dentinal fluid transport in teeth
Protein Length	676 Amino acids
Molecular weight	62283
References	1  PubMed abstract 15805110 2  PubMed abstract 16112392 3  PubMed abstract 7371600
Domain Name	N/A
Hormone Name	Parotid hormone
Mature Hormone Sequence	APPGARPPPGPPPPPPGPSPPRPPPGPPPQ
Position of mature hormone in Pre-Hormone protein	30 Residues from position (647-676)
Receptor	N/A
Gene ID	100049648   100113399
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10115
Swiss-prot Accession number	Q9GKY5 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-99 is essential for obestatin activity (By similarity).
Function	Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation
Protein Length	118 Amino acids
Molecular weight	12786
References	1   Kojima M.; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases. 2   Rousselle J., Lacroix D., Dubreuil P.; Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases. 3   Ying M., Yang Z.; Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Ghrelin
Mature Hormone Sequence	GSSFLSPEHQKVQQRKESKKPAAKLKPR
Position of mature hormone in Pre-Hormone protein	28 Residues from position (25-52)
Receptor	P34999    Detail in HMRbase
Gene ID	396728
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 3

HMRbase accession number	10239
Swiss-prot Accession number	Q95274 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Cytoplasm (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Winteroe A.K., Fredholm M., Davies W.; "Evaluation and characterization of a porcine small intestine cDNAlibrary."; Submitted (JUL-1995) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 16971568
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	733606
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10240
Swiss-prot Accession number	Q95274 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Cytoplasm (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Winteroe A.K., Fredholm M., Davies W.; "Evaluation and characterization of a porcine small intestine cDNAlibrary."; Submitted (JUL-1995) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 16971568
Domain Name	Thymosin
Hormone Name	Hematopoietic system regulatory peptide
Mature Hormone Sequence	SDKP
Position of mature hormone in Pre-Hormone protein	4 Residues from position (2-5)
Receptor	N/A
Gene ID	733606
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10278
Swiss-prot Accession number	P63298 (Sequence in FASTA format)
Description	Secretin precursor (Fragment).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates formation of NaHCO(3)-rich pancreatic juice and secretion of NaHCO(3)-rich bile and inhibits HCl production by the stomach
Protein Length	131 Amino acids
Molecular weight	14278
References	1  PubMed abstract 2315322 2  PubMed abstract 8618828 3  PubMed abstract 5465996 4  PubMed abstract 2395872 5  PubMed abstract 5978238 6  PubMed abstract 2831051 7  PubMed abstract 2883029
Domain Name	Hormone_2
Hormone Name	Secretin
Mature Hormone Sequence	HSDGTFTSELSRLRDSARLQRLLQGLV
Position of mature hormone in Pre-Hormone protein	27 Residues from position (30-56)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10290
Swiss-prot Accession number	Q8HY17 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Insulin-like peptide INSL7) (Insulin-like peptide7) [Contains: Relaxin-3 B chain; Relaxin-3 A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 and relaxin-3 receptor-2
Protein Length	140 Amino acids
Molecular weight	15360
References	1  PubMed abstract 12686464 2  PubMed abstract 12506116 3  PubMed abstract 14522968
Domain Name	Insulin
Hormone Name	Relaxin-3 B chain
Mature Hormone Sequence	RASPYGVKLCGREFIRAVIFTCGGSRW
Position of mature hormone in Pre-Hormone protein	27 Residues from position (27-53)
Receptor	N/A
Gene ID	503836
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10291
Swiss-prot Accession number	Q8HY17 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Insulin-like peptide INSL7) (Insulin-like peptide7) [Contains: Relaxin-3 B chain; Relaxin-3 A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 and relaxin-3 receptor-3
Protein Length	140 Amino acids
Molecular weight	15360
References	1  PubMed abstract 12686464 2  PubMed abstract 12506116 3  PubMed abstract 14522968
Domain Name	Insulin
Hormone Name	Relaxin-3 A chain
Mature Hormone Sequence	DVLAGLSSNCCKWGCSKSEISSLC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (117-140)
Receptor	N/A
Gene ID	503836
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10352
Swiss-prot Accession number	Q9GKY5 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-99 is essential for obestatin activity (By similarity).
Function	Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility
Protein Length	118 Amino acids
Molecular weight	12786
References	1   Kojima M.; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases. 2   Rousselle J., Lacroix D., Dubreuil P.; Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases. 3   Ying M., Yang Z.; Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Obestatin
Mature Hormone Sequence	FNAPCDVGIKLSGAQSDQHGQPL
Position of mature hormone in Pre-Hormone protein	23 Residues from position (77-99)
Receptor	P34999    Detail in HMRbase
Gene ID	396728
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 9

HMRbase accession number	10473
Swiss-prot Accession number	P62968 (Sequence in FASTA format)
Description	Thyroliberin (Thyrotropin-releasing hormone) (TRH) (Thyrotropin-releasing factor) (TRF) (TSH-releasing factor) (Protirelin).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the TRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems
Protein Length	3 Amino acids
Molecular weight	380
References	1  PubMed abstract 4984938 2  PubMed abstract 4982117
Domain Name	N/A
Hormone Name	Thyroliberin
Mature Hormone Sequence	QHP
Position of mature hormone in Pre-Hormone protein	3 Residues from position (1-3)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10477
Swiss-prot Accession number	P63153 (Sequence in FASTA format)
Description	Gastrin-releasing peptide (GRP) [Contains: Neuromedin-C (GRP-10)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the bombesin/neuromedin-B/ranatensin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	GRP stimulates gastrin release as well as other gastrointestinal hormones. Operates as a negative feedback regulating fear and established a causal relationship between GRP-receptor gene expression, long-term potentiation, and amygdala-dependent memory for fear
Protein Length	27 Amino acids
Molecular weight	2806
References	1  PubMed abstract 496973 2  PubMed abstract 6546686
Domain Name	N/A
Hormone Name	Gastrin-releasing peptide
Mature Hormone Sequence	APVSVGGGTVLAKMYPRGNHWAVGHLM
Position of mature hormone in Pre-Hormone protein	27 Residues from position (1-27)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10478
Swiss-prot Accession number	P63153 (Sequence in FASTA format)
Description	Gastrin-releasing peptide (GRP) [Contains: Neuromedin-C (GRP-10)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the bombesin/neuromedin-B/ranatensin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	27 Amino acids
Molecular weight	2806
References	1  PubMed abstract 496973 2  PubMed abstract 6546686
Domain Name	N/A
Hormone Name	Neuromedin-C
Mature Hormone Sequence	GNHWAVGHLM
Position of mature hormone in Pre-Hormone protein	10 Residues from position (18-27)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10506
Swiss-prot Accession number	P79295 (Sequence in FASTA format)
Description	Muellerian-inhibiting factor precursor (MIS) (Anti-Muellerian hormone)(AMH) (Muellerian-inhibiting substance).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the TGF-beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin
Protein Length	575 Amino acids
Molecular weight	61505
References	1   Daneau I., Silversides D.W.; Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Muellerian-inhibiting factor
Mature Hormone Sequence	REEVSSTPALPREPRTGTEGLIFHWDWNWPPPGAWPPGGPQDPLCLVTLNGTPGNGSSPFLWVVGTLSSYEQAFLEAVRHARWGPQDLANFGLCPPSLRQAALPLLQQLQAWLGEPRGQRLVVLHLEEVSWEPTPLLKFQEPLPGEASPLELALLVLYPGPGPEVTVTGAGLPGAQSLCPTRDSGFLALAVDRPERAWRGSGLALTLRRRGNGASLSTAQLQALLFGADSRCFTRMTPALLLLPPQGPVPMPAHGRVDSMPFPQPRLSPEPEEPLPSTDPFLETLTRLVRALRGPPARIPPPSLALDPGALAGFPQGQVNLSDPAALERLLNSEEPLLLLLPPPTAVTAGVPAPLQGPVTEMWASSLARRVATEFQSAAAELRGFPGLPPTATLLLARLLALCPGDRGDPGGPLRAVLLLKALQGLRTEWRWRERSGPARAQRSAGTAVSNGPCALRELSVDLRAERSVLIPETYQANNCQGTCGWPQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR
Position of mature hormone in Pre-Hormone protein	552 Residues from position (24-575)
Receptor	N/A
Gene ID	397578
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10591
Swiss-prot Accession number	P06296 (Sequence in FASTA format)
Description	Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This hormone from hypothalamus regulates the release of corticotropin from pituitary gland
Protein Length	191 Amino acids
Molecular weight	21042
References	1  PubMed abstract 9734873 2  PubMed abstract 12030933 3  PubMed abstract 3878520
Domain Name	CRF
Hormone Name	Corticoliberin
Mature Hormone Sequence	SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Position of mature hormone in Pre-Hormone protein	41 Residues from position (149-189)
Receptor	N/A
Gene ID	100127468
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10687
Swiss-prot Accession number	P01300 (Sequence in FASTA format)
Description	Pancreatic hormone precursor (Pancreatic polypeptide) (PP) (Fragment).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	65 Amino acids
Molecular weight	7290
References	1   Chance R.E., Johnson M.G., Hoffmann J.A., Lin T.-M.; (In) Baba S., Kaneko T., Yanaihara N. (eds.);Proinsulin, insulin, c-peptide, pp.419-425, Excerpta Medica, Amsterdam(1979). 2   Han X.G., Tuch B.E.; "Partial porcine pancreatic polypeptide cDNA sequence (3'end)."; Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	10688
Swiss-prot Accession number	P01300 (Sequence in FASTA format)
Description	Pancreatic hormone precursor (Pancreatic polypeptide) (PP) (Fragment).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	The physiological role for the icosapeptide has not yet been elucidated
Protein Length	65 Amino acids
Molecular weight	7290
References	1   Chance R.E., Johnson M.G., Hoffmann J.A., Lin T.-M.; (In) Baba S., Kaneko T., Yanaihara N. (eds.);Proinsulin, insulin, c-peptide, pp.419-425, Excerpta Medica, Amsterdam(1979). 2   Han X.G., Tuch B.E.; "Partial porcine pancreatic polypeptide cDNA sequence (3'end)."; Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_3
Hormone Name	Pancreatic icosapeptide
Mature Hormone Sequence	DEEDLLDLKCSSLHAAAPR
Position of mature hormone in Pre-Hormone protein	19 Residues from position (40-58)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	10879
Swiss-prot Accession number	P01315 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11672
References	1   Han X.G., Tuch B.E.; "Complete porcine preproinsulin cDNA sequence."; Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 12140686 3  PubMed abstract 14574411 4  PubMed abstract 5657063 5   Chance R.E.; Submitted (JUL-1970) to the PIR data bank. 6   Blundell T.L., Dodson G.G., Hodgkin D., Mercola D.; "Insulin. The structure in the crystal and its reflection in chemistryand biology."; Adv. Protein Chem. 26:279-402(1972). 7   Isaacs N.W., Agarwal R.C.; "Experience with fast Fourier least squares in the refinement of thecrystal structure of rhombohedral 2-zinc insulin at 1.5-Aresolution."; Acta Crystallogr. A 34:782-791(1978). 8  PubMed abstract 2905485 9  PubMed abstract 1772633 10  PubMed abstract 2025410 11  PubMed abstract 15299880
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	397415
PDB ID	1B17   1B18   1B19   1B2A   1B2B   1B2C   1B2D   1B2E   1B2F   1B2G   1DEI   1IZA   1IZB   1M5A   1MPJ   1SDB   1WAV   1ZEI   1ZNI   2EFA   2G4M   2TCI   3INS   3MTH   4INS   6INS   7INS   9INS
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	10880
Swiss-prot Accession number	P01315 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11672
References	1   Han X.G., Tuch B.E.; "Complete porcine preproinsulin cDNA sequence."; Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 12140686 3  PubMed abstract 14574411 4  PubMed abstract 5657063 5   Chance R.E.; Submitted (JUL-1970) to the PIR data bank. 6   Blundell T.L., Dodson G.G., Hodgkin D., Mercola D.; "Insulin. The structure in the crystal and its reflection in chemistryand biology."; Adv. Protein Chem. 26:279-402(1972). 7   Isaacs N.W., Agarwal R.C.; "Experience with fast Fourier least squares in the refinement of thecrystal structure of rhombohedral 2-zinc insulin at 1.5-Aresolution."; Acta Crystallogr. A 34:782-791(1978). 8  PubMed abstract 2905485 9  PubMed abstract 1772633 10  PubMed abstract 2025410 11  PubMed abstract 15299880
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (88-108)
Receptor	N/A
Gene ID	397415
PDB ID	1B17   1B18   1B19   1B2A   1B2B   1B2C   1B2D   1B2E   1B2F   1B2G   1DEI   1IZA   1IZB   1M5A   1MPJ   1SDB   1WAV   1ZEI   1ZNI   2EFA   2G4M   2TCI   3INS   3MTH   4INS   6INS   7INS   9INS
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	11049
Swiss-prot Accession number	P21753 (Sequence in FASTA format)
Description	Thymosin beta-10 (Thymosin beta-9).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	42 Amino acids
Molecular weight	4823
References	1   Cai G., Chen Y., Wang C., Li J., Peng G., Zhang H.; "Generation and analysis of cDNA sequences derived from a porcineskeletal muscle library."; Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2774558 3  PubMed abstract 2090639
Domain Name	Thymosin
Hormone Name	Thymosin beta-10
Mature Hormone Sequence	ADKPDMGEINSFDKAKLKKTETQEKNTLPTKETIEQEKQAK
Position of mature hormone in Pre-Hormone protein	41 Residues from position (2-42)
Receptor	N/A
Gene ID	100037998
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	11112
Swiss-prot Accession number	P01274 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity
Protein Length	180 Amino acids
Molecular weight	21029
References	1   Siggers R.H., Goldade B.G., Laarveld B., Van Kessel A.G.; "Cloning of porcine proglucagon."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 6894800 3  PubMed abstract 7045833 4   Bromer W.W., Sinn L.G., Behrens O.K.; "The amino acid sequence of glucagon. V. Location of amide groups,acid degradation studies and summary of sequential evidence."; J. Am. Chem. Soc. 79:2807-2810(1957). 5  PubMed abstract 2753890 6  PubMed abstract 3379036 7  PubMed abstract 3530719 8  PubMed abstract 12554744 9  PubMed abstract 12626323 10  PubMed abstract 10322410 11  PubMed abstract 10605628 12  PubMed abstract 171582
Domain Name	Hormone_2
Hormone Name	Glicentin
Mature Hormone Sequence	RSLQNTEEKSRSFPAPQTDPLDDPDQMTEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Position of mature hormone in Pre-Hormone protein	69 Residues from position (21-89)
Receptor	N/A
Gene ID	397595
PDB ID	1GCN
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	11113
Swiss-prot Accession number	P01274 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Oxyntomodulin significantly reduces food intake
Protein Length	180 Amino acids
Molecular weight	21029
References	1   Siggers R.H., Goldade B.G., Laarveld B., Van Kessel A.G.; "Cloning of porcine proglucagon."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 6894800 3  PubMed abstract 7045833 4   Bromer W.W., Sinn L.G., Behrens O.K.; "The amino acid sequence of glucagon. V. Location of amide groups,acid degradation studies and summary of sequential evidence."; J. Am. Chem. Soc. 79:2807-2810(1957). 5  PubMed abstract 2753890 6  PubMed abstract 3379036 7  PubMed abstract 3530719 8  PubMed abstract 12554744 9  PubMed abstract 12626323 10  PubMed abstract 10322410 11  PubMed abstract 10605628 12  PubMed abstract 171582
Domain Name	Hormone_2
Hormone Name	Oxyntomodulin
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Position of mature hormone in Pre-Hormone protein	37 Residues from position (53-89)
Receptor	N/A
Gene ID	397595
PDB ID	1GCN
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 21

HMRbase accession number	11114
Swiss-prot Accession number	P01274 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia
Protein Length	180 Amino acids
Molecular weight	21029
References	1   Siggers R.H., Goldade B.G., Laarveld B., Van Kessel A.G.; "Cloning of porcine proglucagon."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 6894800 3  PubMed abstract 7045833 4   Bromer W.W., Sinn L.G., Behrens O.K.; "The amino acid sequence of glucagon. V. Location of amide groups,acid degradation studies and summary of sequential evidence."; J. Am. Chem. Soc. 79:2807-2810(1957). 5  PubMed abstract 2753890 6  PubMed abstract 3379036 7  PubMed abstract 3530719 8  PubMed abstract 12554744 9  PubMed abstract 12626323 10  PubMed abstract 10322410 11  PubMed abstract 10605628 12  PubMed abstract 171582
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (53-81)
Receptor	N/A
Gene ID	397595
PDB ID	1GCN
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 22

HMRbase accession number	11115
Swiss-prot Accession number	P01274 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin
Protein Length	180 Amino acids
Molecular weight	21029
References	1   Siggers R.H., Goldade B.G., Laarveld B., Van Kessel A.G.; "Cloning of porcine proglucagon."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 6894800 3  PubMed abstract 7045833 4   Bromer W.W., Sinn L.G., Behrens O.K.; "The amino acid sequence of glucagon. V. Location of amide groups,acid degradation studies and summary of sequential evidence."; J. Am. Chem. Soc. 79:2807-2810(1957). 5  PubMed abstract 2753890 6  PubMed abstract 3379036 7  PubMed abstract 3530719 8  PubMed abstract 12554744 9  PubMed abstract 12626323 10  PubMed abstract 10322410 11  PubMed abstract 10605628 12  PubMed abstract 171582
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 1
Mature Hormone Sequence	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Position of mature hormone in Pre-Hormone protein	37 Residues from position (92-128)
Receptor	N/A
Gene ID	397595
PDB ID	1GCN
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 23

HMRbase accession number	11116
Swiss-prot Accession number	P01274 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	21029
References	1   Siggers R.H., Goldade B.G., Laarveld B., Van Kessel A.G.; "Cloning of porcine proglucagon."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 6894800 3  PubMed abstract 7045833 4   Bromer W.W., Sinn L.G., Behrens O.K.; "The amino acid sequence of glucagon. V. Location of amide groups,acid degradation studies and summary of sequential evidence."; J. Am. Chem. Soc. 79:2807-2810(1957). 5  PubMed abstract 2753890 6  PubMed abstract 3379036 7  PubMed abstract 3530719 8  PubMed abstract 12554744 9  PubMed abstract 12626323 10  PubMed abstract 10322410 11  PubMed abstract 10605628 12  PubMed abstract 171582
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMNTVLDNLATRDFINWLLHTKITDSL
Position of mature hormone in Pre-Hormone protein	35 Residues from position (146-180)
Receptor	N/A
Gene ID	397595
PDB ID	1GCN
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 24

HMRbase accession number	11152
Swiss-prot Accession number	P01351 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	104 Amino acids
Molecular weight	11558
References	1  PubMed abstract 6951161 2  PubMed abstract 6930858 3  PubMed abstract 14248711 4  PubMed abstract 14248712
Domain Name	Gastrin
Hormone Name	Big gastrin
Mature Hormone Sequence	QLGLQGPPHLVADLAKKQGPWMEEEEEAYGWMDF
Position of mature hormone in Pre-Hormone protein	34 Residues from position (59-92)
Receptor	N/A
Gene ID	445524
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 25

HMRbase accession number	11153
Swiss-prot Accession number	P01351 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	104 Amino acids
Molecular weight	11558
References	1  PubMed abstract 6951161 2  PubMed abstract 6930858 3  PubMed abstract 14248711 4  PubMed abstract 14248712
Domain Name	Gastrin
Hormone Name	Gastrin
Mature Hormone Sequence	QGPWMEEEEEAYGWMDF
Position of mature hormone in Pre-Hormone protein	17 Residues from position (76-92)
Receptor	N/A
Gene ID	445524
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 26

HMRbase accession number	11183
Swiss-prot Accession number	P01356 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Synthesized in both cerebral cortex and duodenal mucosa
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33, CCK39, and CCK58 as well as CCK-octapeptide and the CCK- desoctapeptides. Distribution differences are due to tissue- specific post-translational processing events.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Protein Length	114 Amino acids
Molecular weight	12526
References	1  PubMed abstract 6205394 2   Mutt V., Jorpes J.E.; Submitted (AUG-1970) to the PIR data bank. 3  PubMed abstract 5410106 4  PubMed abstract 8443599
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
Position of mature hormone in Pre-Hormone protein	94 Residues from position (21-114)
Receptor	N/A
Gene ID	397468
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 27

HMRbase accession number	11184
Swiss-prot Accession number	P01356 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Synthesized in both cerebral cortex and duodenal mucosa
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33, CCK39, and CCK58 as well as CCK-octapeptide and the CCK- desoctapeptides. Distribution differences are due to tissue- specific post-translational processing events.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Protein Length	114 Amino acids
Molecular weight	12526
References	1  PubMed abstract 6205394 2   Mutt V., Jorpes J.E.; Submitted (AUG-1970) to the PIR data bank. 3  PubMed abstract 5410106 4  PubMed abstract 8443599
Domain Name	Gastrin
Hormone Name	Cholecystokinin-58
Mature Hormone Sequence	AVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	58 Residues from position (45-102)
Receptor	N/A
Gene ID	397468
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 28

HMRbase accession number	11185
Swiss-prot Accession number	P01356 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Synthesized in both cerebral cortex and duodenal mucosa
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33, CCK39, and CCK58 as well as CCK-octapeptide and the CCK- desoctapeptides. Distribution differences are due to tissue- specific post-translational processing events.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Protein Length	114 Amino acids
Molecular weight	12526
References	1  PubMed abstract 6205394 2   Mutt V., Jorpes J.E.; Submitted (AUG-1970) to the PIR data bank. 3  PubMed abstract 5410106 4  PubMed abstract 8443599
Domain Name	Gastrin
Hormone Name	Cholecystokinin-39
Mature Hormone Sequence	YIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (64-102)
Receptor	N/A
Gene ID	397468
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 29

HMRbase accession number	11186
Swiss-prot Accession number	P01356 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Synthesized in both cerebral cortex and duodenal mucosa
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33, CCK39, and CCK58 as well as CCK-octapeptide and the CCK- desoctapeptides. Distribution differences are due to tissue- specific post-translational processing events.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Protein Length	114 Amino acids
Molecular weight	12526
References	1  PubMed abstract 6205394 2   Mutt V., Jorpes J.E.; Submitted (AUG-1970) to the PIR data bank. 3  PubMed abstract 5410106 4  PubMed abstract 8443599
Domain Name	Gastrin
Hormone Name	Cholecystokinin-33
Mature Hormone Sequence	KAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	33 Residues from position (70-102)
Receptor	N/A
Gene ID	397468
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 30

HMRbase accession number	11187
Swiss-prot Accession number	P01356 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Synthesized in both cerebral cortex and duodenal mucosa
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33, CCK39, and CCK58 as well as CCK-octapeptide and the CCK- desoctapeptides. Distribution differences are due to tissue- specific post-translational processing events.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Protein Length	114 Amino acids
Molecular weight	12526
References	1  PubMed abstract 6205394 2   Mutt V., Jorpes J.E.; Submitted (AUG-1970) to the PIR data bank. 3  PubMed abstract 5410106 4  PubMed abstract 8443599
Domain Name	Gastrin
Hormone Name	Cholecystokinin-12
Mature Hormone Sequence	ISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	12 Residues from position (91-102)
Receptor	N/A
Gene ID	397468
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 31

HMRbase accession number	11188
Swiss-prot Accession number	P01356 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Synthesized in both cerebral cortex and duodenal mucosa
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33, CCK39, and CCK58 as well as CCK-octapeptide and the CCK- desoctapeptides. Distribution differences are due to tissue- specific post-translational processing events.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Protein Length	114 Amino acids
Molecular weight	12526
References	1  PubMed abstract 6205394 2   Mutt V., Jorpes J.E.; Submitted (AUG-1970) to the PIR data bank. 3  PubMed abstract 5410106 4  PubMed abstract 8443599
Domain Name	Gastrin
Hormone Name	Cholecystokinin-8
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (95-102)
Receptor	N/A
Gene ID	397468
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 32

HMRbase accession number	11221
Swiss-prot Accession number	P01348 (Sequence in FASTA format)
Description	Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	182 Amino acids
Molecular weight	20818
References	1  PubMed abstract 6897721 2  PubMed abstract 2442155 3  PubMed abstract 876374 4  PubMed abstract 851452 5  PubMed abstract 843375 6  PubMed abstract 938497 7  PubMed abstract 887933 8  PubMed abstract 622170
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QSTNDFIKACGRELVRLWVEICGSVSWGRTAL
Position of mature hormone in Pre-Hormone protein	32 Residues from position (25-56)
Receptor	N/A
Gene ID	396891
PDB ID	1RLX   2RLX   3RLX   4RLX
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 33

HMRbase accession number	11222
Swiss-prot Accession number	P01348 (Sequence in FASTA format)
Description	Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	182 Amino acids
Molecular weight	20818
References	1  PubMed abstract 6897721 2  PubMed abstract 2442155 3  PubMed abstract 876374 4  PubMed abstract 851452 5  PubMed abstract 843375 6  PubMed abstract 938497 7  PubMed abstract 887933 8  PubMed abstract 622170
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	RMTLSEKCCQVGCIRKDIARLC
Position of mature hormone in Pre-Hormone protein	22 Residues from position (161-182)
Receptor	N/A
Gene ID	396891
PDB ID	1RLX   2RLX   3RLX   4RLX
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 34

HMRbase accession number	11246
Swiss-prot Accession number	P01168 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Somatostatin-28; Somatostatin-14].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	116 Amino acids
Molecular weight	12689
References	1   Liu D., Zhang Y., Zhang X., Yang G.; "Study on SNPs of porcine somatostatin gene."; Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2567292 3  PubMed abstract 2865169 4  PubMed abstract 7353633 5  PubMed abstract 6107906 6  PubMed abstract 1252409 7   Riquet J.; Submitted (SEP-1995) to the EMBL/GenBank/DDBJ databases.
Domain Name	Somatostatin
Hormone Name	Somatostatin-28
Mature Hormone Sequence	SANSNPAMAPRERKAGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	28 Residues from position (89-116)
Receptor	P34994   Detail in HMRbase    Q2Q1V0   Detail in HMRbase    Q6YEX9   Detail in HMRbase    Q6YEY1   Detail in HMRbase    Q866U3    Detail in HMRbase
Gene ID	494469
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 35

HMRbase accession number	11247
Swiss-prot Accession number	P01168 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Somatostatin-28; Somatostatin-14].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	116 Amino acids
Molecular weight	12689
References	1   Liu D., Zhang Y., Zhang X., Yang G.; "Study on SNPs of porcine somatostatin gene."; Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2567292 3  PubMed abstract 2865169 4  PubMed abstract 7353633 5  PubMed abstract 6107906 6  PubMed abstract 1252409 7   Riquet J.; Submitted (SEP-1995) to the EMBL/GenBank/DDBJ databases.
Domain Name	Somatostatin
Hormone Name	Somatostatin-14
Mature Hormone Sequence	AGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (103-116)
Receptor	P34994   Detail in HMRbase    Q2Q1V0   Detail in HMRbase    Q6YEX9   Detail in HMRbase    Q6YEY1   Detail in HMRbase    Q866U3    Detail in HMRbase
Gene ID	494469
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 36

HMRbase accession number	11248
Swiss-prot Accession number	P01177 (Sequence in FASTA format)
Description	Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland
Protein Length	125 Amino acids
Molecular weight	12887
References	1  PubMed abstract 1971513 2  PubMed abstract 13022701 3  PubMed abstract 428540
Domain Name	Hormone_5
Hormone Name	Oxytocin
Mature Hormone Sequence	CYIQNCPLG
Position of mature hormone in Pre-Hormone protein	9 Residues from position (20-28)
Receptor	P32306    Detail in HMRbase
Gene ID	100152272
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 37

HMRbase accession number	11274
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMGHFRWDRF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (77-87)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 38

HMRbase accession number	11275
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (136-174)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 39

HMRbase accession number	11276
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (136-148)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 40

HMRbase accession number	11277
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	91 Residues from position (177-267)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 41

HMRbase accession number	11278
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	58 Residues from position (177-234)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 42

HMRbase accession number	11279
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DEGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (217-234)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 43

HMRbase accession number	11280
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (237-267)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 44

HMRbase accession number	11281
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous opiate
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (237-241)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 45

HMRbase accession number	11303
Swiss-prot Accession number	P01219 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13532
References	1  PubMed abstract 2473932 2   Kato Y., Ezashi T., Hirai T., Kato T.; Submitted (MAR-1992) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 4770796 4   Closset J., Maghuin-Rogister G., Hennen G.; Endocrinol. Exp. 8:164-164(1974). 5  PubMed abstract 4448287 6  PubMed abstract 2473932 7   Kato Y., Ezashi T., Hirai T., Kato T.; Submitted (MAR-1992) to the EMBL/GenBank/DDBJ databases. 8  PubMed abstract 4770796 9   Closset J., Maghuin-Rogister G., Hennen G.; Endocrinol. Exp. 8:164-164(1974). 10  PubMed abstract 4448287
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	P49059   Detail in HMRbase    P16582   Detail in HMRbase    Q8SPP9    Detail in HMRbase
Gene ID	406869
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 46

HMRbase accession number	11307
Swiss-prot Accession number	P01224 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15761
References	1  PubMed abstract 2473932 2  PubMed abstract 8880412 3  PubMed abstract 1245181
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYMMHVERKECAYCLTINTTICAGYCMTRDFNGKLFLPKYALSQDVCTYRDFMYKTVEIPGCPHHVTPYFSYPVAISCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	Q8SPP9    Detail in HMRbase
Gene ID	397658
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 47

HMRbase accession number	11310
Swiss-prot Accession number	P01228 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14605
References	1  PubMed abstract 2174241 2  PubMed abstract 10690358 3  PubMed abstract 3129323 4  PubMed abstract 658036 5  PubMed abstract 2174241 6  PubMed abstract 10690358 7  PubMed abstract 3129323 8  PubMed abstract 658036
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITITVEKEECNFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	P49059    Detail in HMRbase
Gene ID	396895
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 48

HMRbase accession number	11313
Swiss-prot Accession number	P01232 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	14889
References	1  PubMed abstract 2744222 2  PubMed abstract 1701088 3   Lv X., Gao R., Liu S., Li J.; "The sequence and expression of Meishan porcine LH-beta gene."; Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 4770795
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPINATLAAENEACPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELSFASIRLPGCPPGVDPTVSFPVALSCHCGPCRLSSSDCGGPRAQPLACDRPLLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	P16582    Detail in HMRbase
Gene ID	397153
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 49

HMRbase accession number	11316
Swiss-prot Accession number	P01238 (Sequence in FASTA format)
Description	Prolactin precursor (PRL).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Prolactin acts primarily on the mammary gland by promoting lactation
Protein Length	229 Amino acids
Molecular weight	26141
References	1  PubMed abstract 2726463 2  PubMed abstract 2344390 3  PubMed abstract 1270193
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
Position of mature hormone in Pre-Hormone protein	199 Residues from position (31-229)
Receptor	Q6JTA8    Detail in HMRbase
Gene ID	396965
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 50

HMRbase accession number	11322
Swiss-prot Accession number	P01248 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	216 Amino acids
Molecular weight	24429
References	1  PubMed abstract 3666458 2  PubMed abstract 2182128 3  PubMed abstract 2491309 4  PubMed abstract 4918150 5  PubMed abstract 6303731 6  PubMed abstract 1343826 7   Jiang Z.H., Rottmann O.J., Pirchner F.; Submitted (NOV-1996) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_1
Hormone Name	Growth hormone (Somatotropin) (GH)
Mature Hormone Sequence	FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (27-216)
Receptor	P19756    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 51

HMRbase accession number	11325
Swiss-prot Accession number	P01259 (Sequence in FASTA format)
Description	Calcitonin.
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3607
References	1  PubMed abstract 5240032 2  PubMed abstract 5462122 3  PubMed abstract 5693288
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	P25117    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 52

HMRbase accession number	11327
Swiss-prot Accession number	P01269 (Sequence in FASTA format)
Description	Parathyroid hormone precursor (Parathyrin) (PTH).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the parathyroid hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion
Protein Length	115 Amino acids
Molecular weight	12852
References	1  PubMed abstract 3628009 2  PubMed abstract 1164500 3  PubMed abstract 4840833
Domain Name	Parathyroid
Hormone Name	Parathyroid hormone (Parathyrin) (PTH)
Mature Hormone Sequence	SVSEIQLMHNLGKHLSSLERVEWLRKKLQDVHNFVALGASIVHRDGGSQRPRKKEDNVLVESHQKSLGEADKAAVDVLIKAKPQ
Position of mature hormone in Pre-Hormone protein	84 Residues from position (32-115)
Receptor	P50133    Detail in HMRbase
Gene ID	399502
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 53

HMRbase accession number	11335
Swiss-prot Accession number	P01287 (Sequence in FASTA format)
Description	Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone
Protein Length	44 Amino acids
Molecular weight	5110
References	1  PubMed abstract 6418166
Domain Name	Hormone_2
Hormone Name	Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH)
Mature Hormone Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL
Position of mature hormone in Pre-Hormone protein	44 Residues from position (1-44)
Receptor	P34999    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 54

HMRbase accession number	11470
Swiss-prot Accession number	P49921 (Sequence in FASTA format)
Description	Progonadoliberin-1 precursor (Progonadoliberin I) [Contains:Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasinghormone I) (LH-RH I) (Gonadotropin-releasing hormone I) (GnRH-I)(Luliberin I); GnRH-associated peptide 1 (GnRH-associated peptide I)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones
Protein Length	91 Amino acids
Molecular weight	10090
References	1   Weesner G.D., Matteri R.L., Becker B.A.; Submitted (MAY-1994) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 4946067 3  PubMed abstract 4942726 4  PubMed abstract 4946275
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHWSYGLRPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (24-33)
Receptor	P49922    Detail in HMRbase
Gene ID	397516
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 55

HMRbase accession number	11537
Swiss-prot Accession number	Q29406 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Protein Length	167 Amino acids
Molecular weight	18661
References	1  PubMed abstract 8856925
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	O02671   Detail in HMRbase
Gene ID	396832
PDB ID	N/A
Drugpedia	wiki
Comments